PRICKLE3 purified MaxPab mouse polyclonal antibody (B01P)
  • PRICKLE3 purified MaxPab mouse polyclonal antibody (B01P)

PRICKLE3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004007-B01P
PRICKLE3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRICKLE3 protein.
Información adicional
Size 50 ug
Gene Name PRICKLE3
Gene Alias LMO6
Gene Description prickle homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHAVPVDLERIMCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSEAQYCTALEEEEKKELRAFSQQRKRENLGRGIVRIFPVTITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCQELLVDLIYFYHVGKVYCGRHHAECLRPRCQACD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRICKLE3 (ABM85588.1, 1 a.a. ~ 615 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4007

Enviar uma mensagem


PRICKLE3 purified MaxPab mouse polyclonal antibody (B01P)

PRICKLE3 purified MaxPab mouse polyclonal antibody (B01P)