LMO2 monoclonal antibody (M05C), clone 4D3
  • LMO2 monoclonal antibody (M05C), clone 4D3

LMO2 monoclonal antibody (M05C), clone 4D3

Ref: AB-H00004005-M05C
LMO2 monoclonal antibody (M05C), clone 4D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LMO2.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name LMO2
Gene Alias RBTN2|RBTNL1|RHOM2|TTG2
Gene Description LIM domain only 2 (rhombotin-like 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LMO2 (NP_005565.1, 16 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 4005
Clone Number 4D3
Iso type IgG2a Kappa

Enviar uma mensagem


LMO2 monoclonal antibody (M05C), clone 4D3

LMO2 monoclonal antibody (M05C), clone 4D3