View larger
Mouse monoclonal antibody raised against a partial recombinant LMO1.
AB-H00004004-M02
New product
LMO1 monoclonal antibody (M02), clone 1A9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | LMO1 |
| Gene Alias | MGC116692|RBTN1|RHOM1|TTG1 |
| Gene Description | LIM domain only 1 (rhombotin 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LMO1 (NP_002306, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4004 |
| Clone Number | 1A9 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant LMO1.