FADS3 polyclonal antibody (A01)
  • FADS3 polyclonal antibody (A01)

FADS3 polyclonal antibody (A01)

Ref: AB-H00003995-A01
FADS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FADS3.
Información adicional
Size 50 uL
Gene Name FADS3
Gene Alias CYB5RP|LLCDL3
Gene Description fatty acid desaturase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FADS3 (NP_068373, 16 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3995

Enviar uma mensagem


FADS3 polyclonal antibody (A01)

FADS3 polyclonal antibody (A01)