LIPA purified MaxPab rabbit polyclonal antibody (D01P)
  • LIPA purified MaxPab rabbit polyclonal antibody (D01P)

LIPA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003988-D01P
LIPA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LIPA protein.
Información adicional
Size 100 ug
Gene Name LIPA
Gene Alias CESD|LAL
Gene Description lipase A, lysosomal acid, cholesterol esterase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LIPA (AAH12287.1, 1 a.a. ~ 399 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3988

Enviar uma mensagem


LIPA purified MaxPab rabbit polyclonal antibody (D01P)

LIPA purified MaxPab rabbit polyclonal antibody (D01P)