LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)

LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003984-D01P
LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LIMK1 protein.
Información adicional
Size 100 ug
Gene Name LIMK1
Gene Alias LIMK
Gene Description LIM domain kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LIMK1 (AAI52983.1, 1 a.a. ~ 647 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3984

Enviar uma mensagem


LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)

LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)