LHX1 monoclonal antibody (M01), clone 4D1
  • LHX1 monoclonal antibody (M01), clone 4D1

LHX1 monoclonal antibody (M01), clone 4D1

Ref: AB-H00003975-M01
LHX1 monoclonal antibody (M01), clone 4D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LHX1.
Información adicional
Size 100 ug
Gene Name LHX1
Gene Alias LIM-1|LIM1|MGC126723|MGC138141
Gene Description LIM homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3975
Clone Number 4D1
Iso type IgG2a Kappa

Enviar uma mensagem


LHX1 monoclonal antibody (M01), clone 4D1

LHX1 monoclonal antibody (M01), clone 4D1