LGALS7 monoclonal antibody (M01), clone 6B5
  • LGALS7 monoclonal antibody (M01), clone 6B5

LGALS7 monoclonal antibody (M01), clone 6B5

Ref: AB-H00003963-M01
LGALS7 monoclonal antibody (M01), clone 6B5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant LGALS7.
Información adicional
Size 100 ug
Gene Name LGALS7
Gene Alias GAL7|LGALS7A
Gene Description lectin, galactoside-binding, soluble, 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LGALS7 (NP_002298.1, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3963
Clone Number 6B5
Iso type IgG2a Kappa

Enviar uma mensagem


LGALS7 monoclonal antibody (M01), clone 6B5

LGALS7 monoclonal antibody (M01), clone 6B5