LGALS3BP MaxPab rabbit polyclonal antibody (D01)
  • LGALS3BP MaxPab rabbit polyclonal antibody (D01)

LGALS3BP MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003959-D01
LGALS3BP MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LGALS3BP protein.
Información adicional
Size 100 uL
Gene Name LGALS3BP
Gene Alias 90K|BTBD17B|MAC-2-BP
Gene Description lectin, galactoside-binding, soluble, 3 binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IP
Immunogen Prot. Seq MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQGYCASLFAILLPQDP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LGALS3BP (NP_005558.1, 1 a.a. ~ 585 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3959

Enviar uma mensagem


LGALS3BP MaxPab rabbit polyclonal antibody (D01)

LGALS3BP MaxPab rabbit polyclonal antibody (D01)