LETM1 polyclonal antibody (A01)
  • LETM1 polyclonal antibody (A01)

LETM1 polyclonal antibody (A01)

Ref: AB-H00003954-A01
LETM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LETM1.
Información adicional
Size 50 uL
Gene Name LETM1
Gene Alias -
Gene Description leucine zipper-EF-hand containing transmembrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LETM1 (NP_036450, 601 a.a. ~ 708 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3954

Enviar uma mensagem


LETM1 polyclonal antibody (A01)

LETM1 polyclonal antibody (A01)