LEPR polyclonal antibody (A01)
  • LEPR polyclonal antibody (A01)

LEPR polyclonal antibody (A01)

Ref: AB-H00003953-A01
LEPR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LEPR.
Información adicional
Size 50 uL
Gene Name LEPR
Gene Alias CD295|OBR
Gene Description leptin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LEPR (NP_001003679, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3953

Enviar uma mensagem


LEPR polyclonal antibody (A01)

LEPR polyclonal antibody (A01)