LDHC purified MaxPab rabbit polyclonal antibody (D01P)
  • LDHC purified MaxPab rabbit polyclonal antibody (D01P)

LDHC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003948-D01P
LDHC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LDHC protein.
Información adicional
Size 100 ug
Gene Name LDHC
Gene Alias CT32|LDH3|LDHX|MGC111073
Gene Description lactate dehydrogenase C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LDHC (NP_002292.1, 1 a.a. ~ 332 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3948

Enviar uma mensagem


LDHC purified MaxPab rabbit polyclonal antibody (D01P)

LDHC purified MaxPab rabbit polyclonal antibody (D01P)