LCP2 purified MaxPab mouse polyclonal antibody (B01P)
  • LCP2 purified MaxPab mouse polyclonal antibody (B01P)

LCP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003937-B01P
LCP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LCP2 protein.
Información adicional
Size 50 ug
Gene Name LCP2
Gene Alias SLP-76|SLP76
Gene Description lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LCP2 (NP_005556, 1 a.a. ~ 533 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3937

Enviar uma mensagem


LCP2 purified MaxPab mouse polyclonal antibody (B01P)

LCP2 purified MaxPab mouse polyclonal antibody (B01P)