LCN1 monoclonal antibody (M02), clone 1B11
  • LCN1 monoclonal antibody (M02), clone 1B11

LCN1 monoclonal antibody (M02), clone 1B11

Ref: AB-H00003933-M02
LCN1 monoclonal antibody (M02), clone 1B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LCN1.
Información adicional
Size 100 ug
Gene Name LCN1
Gene Alias MGC71975|PMFA|TP|VEGP
Gene Description lipocalin 1 (tear prealbumin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LCN1 (NP_002288, 24 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3933
Clone Number 1B11
Iso type IgG2a Kappa

Enviar uma mensagem


LCN1 monoclonal antibody (M02), clone 1B11

LCN1 monoclonal antibody (M02), clone 1B11