LCN1 polyclonal antibody (A01)
  • LCN1 polyclonal antibody (A01)

LCN1 polyclonal antibody (A01)

Ref: AB-H00003933-A01
LCN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LCN1.
Información adicional
Size 50 uL
Gene Name LCN1
Gene Alias MGC71975|PMFA|TP|VEGP
Gene Description lipocalin 1 (tear prealbumin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LCN1 (NP_002288, 24 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3933

Enviar uma mensagem


LCN1 polyclonal antibody (A01)

LCN1 polyclonal antibody (A01)