LCAT polyclonal antibody (A01)
  • LCAT polyclonal antibody (A01)

LCAT polyclonal antibody (A01)

Ref: AB-H00003931-A01
LCAT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LCAT.
Información adicional
Size 50 uL
Gene Name LCAT
Gene Alias -
Gene Description lecithin-cholesterol acyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq CWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LCAT (AAH14781, 98 a.a. ~ 197 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3931

Enviar uma mensagem


LCAT polyclonal antibody (A01)

LCAT polyclonal antibody (A01)