STMN1 monoclonal antibody (M01A), clone 3A9
  • STMN1 monoclonal antibody (M01A), clone 3A9

STMN1 monoclonal antibody (M01A), clone 3A9

Ref: AB-H00003925-M01A
STMN1 monoclonal antibody (M01A), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STMN1.
Información adicional
Size 200 uL
Gene Name STMN1
Gene Alias LAP18|Lag|OP18|PP17|PP19|PR22|SMN
Gene Description stathmin 1/oncoprotein 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STMN1 (AAH14353, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 3925
Clone Number 3A9
Iso type IgM Kappa

Enviar uma mensagem


STMN1 monoclonal antibody (M01A), clone 3A9

STMN1 monoclonal antibody (M01A), clone 3A9