LAMP2 monoclonal antibody (M01), clone 2G10
  • LAMP2 monoclonal antibody (M01), clone 2G10

LAMP2 monoclonal antibody (M01), clone 2G10

Ref: AB-H00003920-M01
LAMP2 monoclonal antibody (M01), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LAMP2.
Información adicional
Size 100 ug
Gene Name LAMP2
Gene Alias CD107b|LAMPB|LGP110
Gene Description lysosomal-associated membrane protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3920
Clone Number 2G10
Iso type IgG2a Kappa

Enviar uma mensagem


LAMP2 monoclonal antibody (M01), clone 2G10

LAMP2 monoclonal antibody (M01), clone 2G10