LAMB3 polyclonal antibody (A01)
  • LAMB3 polyclonal antibody (A01)

LAMB3 polyclonal antibody (A01)

Ref: AB-H00003914-A01
LAMB3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LAMB3.
Información adicional
Size 50 uL
Gene Name LAMB3
Gene Alias BM600-125KDA|FLJ99565|LAM5|LAMNB1
Gene Description laminin, beta 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3914

Enviar uma mensagem


LAMB3 polyclonal antibody (A01)

LAMB3 polyclonal antibody (A01)