LAMA5 polyclonal antibody (A01)
  • LAMA5 polyclonal antibody (A01)

LAMA5 polyclonal antibody (A01)

Ref: AB-H00003911-A01
LAMA5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LAMA5.
Información adicional
Size 50 uL
Gene Name LAMA5
Gene Alias KIAA1907
Gene Description laminin, alpha 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMA5 (AAH03355, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3911

Enviar uma mensagem


LAMA5 polyclonal antibody (A01)

LAMA5 polyclonal antibody (A01)