LAMA2 monoclonal antibody (M01), clone 2D4
  • LAMA2 monoclonal antibody (M01), clone 2D4

LAMA2 monoclonal antibody (M01), clone 2D4

Ref: AB-H00003908-M01
LAMA2 monoclonal antibody (M01), clone 2D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LAMA2.
Información adicional
Size 50 ug
Gene Name LAMA2
Gene Alias LAMM
Gene Description laminin, alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3908
Clone Number 2D4
Iso type IgG1 Kappa

Enviar uma mensagem


LAMA2 monoclonal antibody (M01), clone 2D4

LAMA2 monoclonal antibody (M01), clone 2D4