KRT32 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT32 purified MaxPab rabbit polyclonal antibody (D01P)

KRT32 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003882-D01P
KRT32 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT32 protein.
Información adicional
Size 100 ug
Gene Name KRT32
Gene Alias HA2|HKA2|KRTHA2|hHa2
Gene Description keratin 32
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPASCLSKTYLSSSCQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQENAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT32 (AAI48741.1, 1 a.a. ~ 448 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3882

Enviar uma mensagem


KRT32 purified MaxPab rabbit polyclonal antibody (D01P)

KRT32 purified MaxPab rabbit polyclonal antibody (D01P)