KRT16 polyclonal antibody (A01)
  • KRT16 polyclonal antibody (A01)

KRT16 polyclonal antibody (A01)

Ref: AB-H00003868-A01
KRT16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KRT16.
Información adicional
Size 50 uL
Gene Name KRT16
Gene Alias CK16|K16|K1CP|KRT16A|NEPPK
Gene Description keratin 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KRT16 (NP_005548, 301 a.a. ~ 398 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3868

Enviar uma mensagem


KRT16 polyclonal antibody (A01)

KRT16 polyclonal antibody (A01)