KRT12 purified MaxPab rabbit polyclonal antibody (D01P)
  • KRT12 purified MaxPab rabbit polyclonal antibody (D01P)

KRT12 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003859-D01P
KRT12 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT12 protein.
Información adicional
Size 100 ug
Gene Name KRT12
Gene Alias K12
Gene Description keratin 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFGASCGGGFSAASMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLDELTLTRTDLEMQIES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT12 (AAI56642.1, 1 a.a. ~ 494 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3859

Enviar uma mensagem


KRT12 purified MaxPab rabbit polyclonal antibody (D01P)

KRT12 purified MaxPab rabbit polyclonal antibody (D01P)