KRT8 MaxPab rabbit polyclonal antibody (D01)
  • KRT8 MaxPab rabbit polyclonal antibody (D01)

KRT8 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003856-D01
KRT8 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KRT8 protein.
Información adicional
Size 100 uL
Gene Name KRT8
Gene Alias CARD2|CK8|CYK8|K2C8|K8|KO
Gene Description keratin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT8 (NP_002264.1, 1 a.a. ~ 483 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3856

Enviar uma mensagem


KRT8 MaxPab rabbit polyclonal antibody (D01)

KRT8 MaxPab rabbit polyclonal antibody (D01)