KRT6B purified MaxPab mouse polyclonal antibody (B01P)
  • KRT6B purified MaxPab mouse polyclonal antibody (B01P)

KRT6B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003854-B01P
KRT6B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KRT6B protein.
Información adicional
Size 50 ug
Gene Name KRT6B
Gene Alias CK6B|K6B|KRTL1|PC2
Gene Description keratin 6B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLKNKYED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KRT6B (ABM85437.1, 1 a.a. ~ 564 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3854

Enviar uma mensagem


KRT6B purified MaxPab mouse polyclonal antibody (B01P)

KRT6B purified MaxPab mouse polyclonal antibody (B01P)