KRAS monoclonal antibody (M02J), clone 4F3
  • KRAS monoclonal antibody (M02J), clone 4F3

KRAS monoclonal antibody (M02J), clone 4F3

Ref: AB-H00003845-M02J
KRAS monoclonal antibody (M02J), clone 4F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KRAS.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name KRAS
Gene Alias C-K-RAS|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS3|RASK2
Gene Description v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3845
Clone Number 4F3
Iso type IgG2a Kappa

Enviar uma mensagem


KRAS monoclonal antibody (M02J), clone 4F3

KRAS monoclonal antibody (M02J), clone 4F3