KPNA2 polyclonal antibody (A01)
  • KPNA2 polyclonal antibody (A01)

KPNA2 polyclonal antibody (A01)

Ref: AB-H00003838-A01
KPNA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KPNA2.
Información adicional
Size 50 uL
Gene Name KPNA2
Gene Alias IPOA1|QIP2|RCH1|SRP1alpha
Gene Description karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KPNA2 (NP_002257, 420 a.a. ~ 528 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3838

Enviar uma mensagem


KPNA2 polyclonal antibody (A01)

KPNA2 polyclonal antibody (A01)