KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003836-D01P
KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KPNA1 protein.
Información adicional
Size 100 ug
Gene Name KPNA1
Gene Alias IPOA5|NPI-1|RCH2|SRP1
Gene Description karyopherin alpha 1 (importin alpha 5)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KPNA1 (NP_002255.2, 1 a.a. ~ 538 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3836

Enviar uma mensagem


KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)

KPNA1 purified MaxPab rabbit polyclonal antibody (D01P)