KIFC1 monoclonal antibody (M01), clone 2B9
  • KIFC1 monoclonal antibody (M01), clone 2B9

KIFC1 monoclonal antibody (M01), clone 2B9

Ref: AB-H00003833-M01
KIFC1 monoclonal antibody (M01), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KIFC1.
Información adicional
Size 100 ug
Gene Name KIFC1
Gene Alias HSET|KNSL2|MGC1202|MGC149736|MGC149737
Gene Description kinesin family member C1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIFC1 (AAH00712, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3833
Clone Number 2B9
Iso type IgG2a Kappa

Enviar uma mensagem


KIFC1 monoclonal antibody (M01), clone 2B9

KIFC1 monoclonal antibody (M01), clone 2B9