KLC1 purified MaxPab mouse polyclonal antibody (B01P)
  • KLC1 purified MaxPab mouse polyclonal antibody (B01P)

KLC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003831-B01P
KLC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KLC1 protein.
Información adicional
Size 50 ug
Gene Name KLC1
Gene Alias KLC|KNS2|KNS2A|MGC15245
Gene Description kinesin light chain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLC1 (NP_005543.2, 1 a.a. ~ 560 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3831

Enviar uma mensagem


KLC1 purified MaxPab mouse polyclonal antibody (B01P)

KLC1 purified MaxPab mouse polyclonal antibody (B01P)