KLRC1 polyclonal antibody (A01)
  • KLRC1 polyclonal antibody (A01)

KLRC1 polyclonal antibody (A01)

Ref: AB-H00003821-A01
KLRC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLRC1.
Información adicional
Size 50 uL
Gene Name KLRC1
Gene Alias CD159A|MGC13374|MGC59791|NKG2|NKG2A
Gene Description killer cell lectin-like receptor subfamily C, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3821

Enviar uma mensagem


KLRC1 polyclonal antibody (A01)

KLRC1 polyclonal antibody (A01)