KLK1 polyclonal antibody (A01)
  • KLK1 polyclonal antibody (A01)

KLK1 polyclonal antibody (A01)

Ref: AB-H00003816-A01
KLK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLK1.
Información adicional
Size 50 uL
Gene Name KLK1
Gene Alias KLKR|Klk6|hK1
Gene Description kallikrein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK1 (AAH05313, 168 a.a. ~ 262 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3816

Enviar uma mensagem


KLK1 polyclonal antibody (A01)

KLK1 polyclonal antibody (A01)