KIR3DL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • KIR3DL1 purified MaxPab rabbit polyclonal antibody (D01P)

KIR3DL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003811-D01P
KIR3DL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIR3DL1 protein.
Información adicional
Size 100 ug
Gene Name KIR3DL1
Gene Alias CD158E1|KIR|MGC119726|MGC119728|MGC126589|MGC126591|NKAT3|NKB1|NKB1B
Gene Description killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIR3DL1 (NP_001077008.1, 1 a.a. ~ 382 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3811

Enviar uma mensagem


KIR3DL1 purified MaxPab rabbit polyclonal antibody (D01P)

KIR3DL1 purified MaxPab rabbit polyclonal antibody (D01P)