KIR2DS3 purified MaxPab rabbit polyclonal antibody (D01P)
  • KIR2DS3 purified MaxPab rabbit polyclonal antibody (D01P)

KIR2DS3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003808-D01P
KIR2DS3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIR2DS3 protein.
Información adicional
Size 100 ug
Gene Name KIR2DS3
Gene Alias NKAT7
Gene Description killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIR2DS3 (AAI56609.1, 1 a.a. ~ 304 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3808

Enviar uma mensagem


KIR2DS3 purified MaxPab rabbit polyclonal antibody (D01P)

KIR2DS3 purified MaxPab rabbit polyclonal antibody (D01P)