KIR2DL4 purified MaxPab rabbit polyclonal antibody (D01P)
  • KIR2DL4 purified MaxPab rabbit polyclonal antibody (D01P)

KIR2DL4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003805-D01P
KIR2DL4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIR2DL4 protein.
Información adicional
Size 100 ug
Gene Name KIR2DL4
Gene Alias CD158D|G9P|KIR103|KIR103AS
Gene Description killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIR2DL4 (AAH41611.1, 1 a.a. ~ 377 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3805

Enviar uma mensagem


KIR2DL4 purified MaxPab rabbit polyclonal antibody (D01P)

KIR2DL4 purified MaxPab rabbit polyclonal antibody (D01P)