KIR2DL3 purified MaxPab rabbit polyclonal antibody (D01P)
  • KIR2DL3 purified MaxPab rabbit polyclonal antibody (D01P)

KIR2DL3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003804-D01P
KIR2DL3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIR2DL3 protein.
Información adicional
Size 100 ug
Gene Name KIR2DL3
Gene Alias CD158B2|CD158b|GL183|KIR-023GB|KIR-K7b|KIR-K7c|KIRCL23|MGC129943|NKAT|NKAT2|NKAT2A|NKAT2B|p58
Gene Description killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIR2DL3 (NP_056952.2, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3804

Enviar uma mensagem


KIR2DL3 purified MaxPab rabbit polyclonal antibody (D01P)

KIR2DL3 purified MaxPab rabbit polyclonal antibody (D01P)