KIR2DL1 purified MaxPab mouse polyclonal antibody (B01P)
  • KIR2DL1 purified MaxPab mouse polyclonal antibody (B01P)

KIR2DL1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003802-B01P
KIR2DL1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIR2DL1 protein.
Información adicional
Size 50 ug
Gene Name KIR2DL1
Gene Alias CD158A|KIR-K64|KIR221|NKAT|NKAT1|p58.1
Gene Description killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTERMFHHVGQACLKLPTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIR2DL1 (AAH69344.1, 1 a.a. ~ 374 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3802

Enviar uma mensagem


KIR2DL1 purified MaxPab mouse polyclonal antibody (B01P)

KIR2DL1 purified MaxPab mouse polyclonal antibody (B01P)