KIFC3 purified MaxPab mouse polyclonal antibody (B01P)
  • KIFC3 purified MaxPab mouse polyclonal antibody (B01P)

KIFC3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003801-B01P
KIFC3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIFC3 protein.
Información adicional
Size 50 ug
Gene Name KIFC3
Gene Alias DKFZp686D23201|FLJ34694
Gene Description kinesin family member C3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLPQLQLEMAESKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQIAMYESELERAHGQMLEEMQSLEEDKNRAIEEAFARAQVEMKAVHENLAGVRTNLLTLQPALRTLTNDYNGLKRQVRGFPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIFC3 (AAH34234.1, 1 a.a. ~ 687 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3801

Enviar uma mensagem


KIFC3 purified MaxPab mouse polyclonal antibody (B01P)

KIFC3 purified MaxPab mouse polyclonal antibody (B01P)