KIF3C purified MaxPab mouse polyclonal antibody (B01P)
  • KIF3C purified MaxPab mouse polyclonal antibody (B01P)

KIF3C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003797-B01P
KIF3C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIF3C protein.
Información adicional
Size 50 ug
Gene Name KIF3C
Gene Alias -
Gene Description kinesin family member 3C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTFDAVYDASSKQADLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKEPGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGSTHMNEVSSRSHAIFIITVECSERGSDGQDHIRVGKLNLVDLAGSERQNK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIF3C (NP_002245.4, 1 a.a. ~ 793 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3797

Enviar uma mensagem


KIF3C purified MaxPab mouse polyclonal antibody (B01P)

KIF3C purified MaxPab mouse polyclonal antibody (B01P)