KHK polyclonal antibody (A01)
  • KHK polyclonal antibody (A01)

KHK polyclonal antibody (A01)

Ref: AB-H00003795-A01
KHK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant KHK.
Información adicional
Size 50 uL
Gene Name KHK
Gene Alias -
Gene Description ketohexokinase (fructokinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KHK (AAH06233, 1 a.a. ~ 298 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3795

Enviar uma mensagem


KHK polyclonal antibody (A01)

KHK polyclonal antibody (A01)