KEL monoclonal antibody (M01), clone 4B10
  • KEL monoclonal antibody (M01), clone 4B10

KEL monoclonal antibody (M01), clone 4B10

Ref: AB-H00003792-M01
KEL monoclonal antibody (M01), clone 4B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KEL.
Información adicional
Size 100 ug
Gene Name KEL
Gene Alias CD238|ECE3
Gene Description Kell blood group, metallo-endopeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LENAADVGGLAIALQAYSKRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRCARGALLNPSSRCQLW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KEL (NP_000411.1, 633 a.a. ~ 732 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3792
Clone Number 4B10
Iso type IgG2a Kappa

Enviar uma mensagem


KEL monoclonal antibody (M01), clone 4B10

KEL monoclonal antibody (M01), clone 4B10