KDR monoclonal antibody (M03), clone 2C5
  • KDR monoclonal antibody (M03), clone 2C5

KDR monoclonal antibody (M03), clone 2C5

Ref: AB-H00003791-M03
KDR monoclonal antibody (M03), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KDR.
Información adicional
Size 100 ug
Gene Name KDR
Gene Alias CD309|FLK1|VEGFR|VEGFR2
Gene Description kinase insert domain receptor (a type III receptor tyrosine kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KDR (NP_002244, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3791
Clone Number 2C5
Iso type IgG2a Kappa

Enviar uma mensagem


KDR monoclonal antibody (M03), clone 2C5

KDR monoclonal antibody (M03), clone 2C5