KCNJ1 polyclonal antibody (A01)
  • KCNJ1 polyclonal antibody (A01)

KCNJ1 polyclonal antibody (A01)

Ref: AB-H00003758-A01
KCNJ1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KCNJ1.
Información adicional
Size 50 uL
Gene Name KCNJ1
Gene Alias KIR1.1|ROMK|ROMK1
Gene Description potassium inwardly-rectifying channel, subfamily J, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNJ1 (NP_000211, 292 a.a. ~ 391 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3758

Enviar uma mensagem


KCNJ1 polyclonal antibody (A01)

KCNJ1 polyclonal antibody (A01)