KCNE1 purified MaxPab mouse polyclonal antibody (B01P)
  • KCNE1 purified MaxPab mouse polyclonal antibody (B01P)

KCNE1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003753-B01P
KCNE1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KCNE1 protein.
Información adicional
Size 50 ug
Gene Name KCNE1
Gene Alias FLJ18426|FLJ38123|FLJ94103|ISK|JLNS|JLNS2|LQT2/5|LQT5|MGC33114|MinK
Gene Description potassium voltage-gated channel, Isk-related family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KCNE1 (NP_000210.2, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3753

Enviar uma mensagem


KCNE1 purified MaxPab mouse polyclonal antibody (B01P)

KCNE1 purified MaxPab mouse polyclonal antibody (B01P)