KCNC3 monoclonal antibody (M02), clone 6F7
  • KCNC3 monoclonal antibody (M02), clone 6F7

KCNC3 monoclonal antibody (M02), clone 6F7

Ref: AB-H00003748-M02
KCNC3 monoclonal antibody (M02), clone 6F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KCNC3.
Información adicional
Size 100 ug
Gene Name KCNC3
Gene Alias KSHIIID|KV3.3|SCA13
Gene Description potassium voltage-gated channel, Shaw-related subfamily, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3748
Clone Number 6F7
Iso type IgG2b Kappa

Enviar uma mensagem


KCNC3 monoclonal antibody (M02), clone 6F7

KCNC3 monoclonal antibody (M02), clone 6F7