JUN purified MaxPab mouse polyclonal antibody (B01P)
  • JUN purified MaxPab mouse polyclonal antibody (B01P)

JUN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003725-B01P
JUN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human JUN protein.
Información adicional
Size 50 ug
Gene Name JUN
Gene Alias AP-1|AP1|c-Jun
Gene Description jun oncogene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen JUN (AAH68522.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3725

Enviar uma mensagem


JUN purified MaxPab mouse polyclonal antibody (B01P)

JUN purified MaxPab mouse polyclonal antibody (B01P)