ITPR1 monoclonal antibody (M01), clone 2B6
  • ITPR1 monoclonal antibody (M01), clone 2B6

ITPR1 monoclonal antibody (M01), clone 2B6

Ref: AB-H00003708-M01
ITPR1 monoclonal antibody (M01), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITPR1.
Información adicional
Size 100 ug
Gene Name ITPR1
Gene Alias INSP3R1|IP3R|IP3R1|SCA15|SCA16
Gene Description inositol 1,4,5-triphosphate receptor, type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITPR1 (NP_002213, 2470 a.a. ~ 2577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3708
Clone Number 2B6
Iso type IgG2a Kappa

Enviar uma mensagem


ITPR1 monoclonal antibody (M01), clone 2B6

ITPR1 monoclonal antibody (M01), clone 2B6