ITPKB purified MaxPab mouse polyclonal antibody (B01P)
  • ITPKB purified MaxPab mouse polyclonal antibody (B01P)

ITPKB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003707-B01P
ITPKB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ITPKB protein.
Información adicional
Size 50 ug
Gene Name ITPKB
Gene Alias IP3K|IP3K-B|IP3KB|PIG37
Gene Description inositol 1,4,5-trisphosphate 3-kinase B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRAHSPSPCPFRSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGRAAPTGSEAQGPSAFV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITPKB (AAH15009.1, 1 a.a. ~ 644 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3707

Enviar uma mensagem


ITPKB purified MaxPab mouse polyclonal antibody (B01P)

ITPKB purified MaxPab mouse polyclonal antibody (B01P)