ITPA monoclonal antibody (M01), clone 2H8
  • ITPA monoclonal antibody (M01), clone 2H8

ITPA monoclonal antibody (M01), clone 2H8

Ref: AB-H00003704-M01
ITPA monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITPA.
Información adicional
Size 100 ug
Gene Name ITPA
Gene Alias C20orf37|HLC14-06-P|ITPase|dJ794I6.3
Gene Description inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITPA (NP_258412.1, 89 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3704
Clone Number 2H8
Iso type IgG2a Kappa

Enviar uma mensagem


ITPA monoclonal antibody (M01), clone 2H8

ITPA monoclonal antibody (M01), clone 2H8